PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AS_32A35158A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family SBP
Protein Properties Length: 328aa    MW: 35420.8 Da    PI: 9.4749
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AS_32A35158A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.97.8e-4060137178
                            --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                    SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                            +CqvegC ++l +akeyhr+h+vCe+h+k p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Traes_6AS_32A35158A.1  60 RCQVEGCGVELRDAKEYHRKHRVCEAHTKFPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 137
                            6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-3354122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.97558135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.94E-3959140IPR004333Transcription factor, SBP-box
PfamPF031107.0E-3161134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEWTAPKSTP LSPPHLLWDW GDAAAPGSSG EAAGRRGKEK RARGEAAGGG GGGGGGGGVR  60
CQVEGCGVEL RDAKEYHRKH RVCEAHTKFP RVVVAGQERR FCQQCSRFHA LSEFDQKKRS  120
CRRRLSDHNA RRRKPQPDAF SFTPARLPSS LVFDDRRQIS FVWNKDPLSH ARPFPCSPWD  180
SPSDFKLPQV KEIREVSING QVHFDKSHLP NAVPALSHDI AELLPMKGPD ASVTASKLGG  240
APDLQRALSL LSASSCGLPD PVQQASCLVQ FTGASQNSRG PSPHGGSPPS ASCAEGQPMA  300
PSPQFVRFTM DGASSGYEST FFGVNRMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2752134184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116133KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3616100.0AK361610.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1144O20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570368.10.0PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z55e-97SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLW5GCP70.0W5GCP7_WHEAT; Uncharacterized protein
STRINGMLOC_62426.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-38squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]